PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp1016s0011.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 521aa    MW: 56862.7 Da    PI: 5.1555
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp1016s0011.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.52.8e-33110166259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +DgynWrKYGqK+vkgsefprsYY+Ct+++C+++k+ver++ d++++ei+Y+g+Hnh+
  Kaladp1016s0011.2.p 110 EDGYNWRKYGQKQVKGSEFPRSYYKCTHPNCEMRKQVERTH-DGQITEIVYKGNHNHP 166
                          7***************************************9.***************8 PP

2WRKY104.74.9e-33300358159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC v+k+ver+ +d+k+v++tYeg+Hnhe
  Kaladp1016s0011.2.p 300 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTPGCLVRKHVERAPDDNKCVVTTYEGKHNHE 358
                          59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081124.512104168IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-29106168IPR003657WRKY domain
SuperFamilySSF1182905.36E-26106168IPR003657WRKY domain
SMARTSM007741.1E-36109167IPR003657WRKY domain
PfamPF031061.9E-26110166IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.4E-35285360IPR003657WRKY domain
SuperFamilySSF1182909.81E-29295360IPR003657WRKY domain
PROSITE profilePS5081136.896295360IPR003657WRKY domain
SMARTSM007746.0E-38300359IPR003657WRKY domain
PfamPF031064.4E-25301358IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MLAGVCGILQ DLDGGFLNLP SQQLPIEFEL PVLSNEFIAS ASIRNDYIDV DFLSPADLSN  60
AHTTLPPSQP NDHITSQRND HMYIDGAADH VMEEEKRASS PPMGGMRTTE DGYNWRKYGQ  120
KQVKGSEFPR SYYKCTHPNC EMRKQVERTH DGQITEIVYK GNHNHPQPMP NRRLTPDSAF  180
AQNEMDAGEG CGGGTSRGKN EGLDRALSEP ILTELSPTGR EKRFSAFDSS EAAELASPLH  240
NHAAEDDEAV EENMADANEV HNDATDLRRA EDCMVEPSMS SRGVREQKIV VEIETEVDIL  300
DDGYRWRKYG QKVVKGNPNP RSYYKCTTPG CLVRKHVERA PDDNKCVVTT YEGKHNHEVP  360
AAKNSSNASP NAGHLSSAHP VGQPSHMPLA GSAAITMPAQ AQFQPPPFES KPYMGNGFSA  420
HSLPGNFGND VSFGASSMYP MLYGSFGLAA SYPNIQRAGL SISRSPILDS AAANPMTLHY  480
GFDNHRGGGV IQTAHPGDEN DPTRRGPKQD EANDEPADDS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-35110361878Probable WRKY transcription factor 4
2lex_A2e-35110361878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ6VWJ64e-77WRK46_HORVU; WRKY transcription factor SUSIBA2
STRINGGLYMA18G47741.11e-100(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.17e-74WRKY family protein